ColabFold / AlphaFold2_advanced on your local PC (or macOS)

Installation

Make sure curl and wget commands are already installed on your PC. If not present, you need install them at first. For Ubuntu, type sudo apt -y install curl wget.
Download install_colabfold_linux.sh from this repository:$ wget https://raw.githubusercontent.com/YoshitakaMo/localcolabfold/main/install_colabfold_linux.shand run it in the directory where you want to install:$ bash install_colabfold_linux.shAbout 5 minutes later, colabfold directory will be created. Do not move this directory after the installation.
Type cd colabfold to enter the directory.
Modify the variables such as sequence = 'PIAQIHILEGRSDEQKETLIREVSEAISRSLDAPLTSVRVIITEMAKGHFGIGGELASK', jobname = "test", and etc. in runner.py for your prediction. For more information, please refer to the original ColabFold / AlphaFold2_advanced.
To run the prediction, type$ colabfold-conda/bin/python3.7 runner.pyin the colabfold directory. The result files will be

To finish reading, please visit source site